[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB80582.1 cper0 CPE0876 "hypothetical protein"
MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEK
IEGVILGNLEQWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMK
GSTAEAFYNKRGYEIPKELIMMRKKLK
//