[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1028"

CPE1028     "conserved hypothetical protein"
            ""

OrgPattern --------------------------------------------------11--111111-------- -------------------------------------------------------------------------------------1-1---------------------------------------------------1----------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDF:Sequence :ccccccEEEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEcccccccccEEEEEE:Sec Str : ====================================================:RP:SCP|9->66|1o51A|3e-11|33.9|56/89|d.58.5.4 : ===================================================:BL:SWS|10->99|Y666_PYRAB|2e-11|36.7|90/127 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->101|PF02641|6e-11|31.6|95/101|DUF190 61: . . . * . .: 120 :IEILARNLPIVIEVIESKEKINELIELIEPMIETGTITVIDNIQVISLNKKTD :Sequence :EEEcTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEE EEEccc :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|70->89|ivievieskekinelielie :====== :RP:SCP|9->66|1o51A|3e-11|33.9|56/89|d.58.5.4 :======================================= :BL:SWS|10->99|Y666_PYRAB|2e-11|36.7|90/127 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->101|PF02641|6e-11|31.6|95/101|DUF190