[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB80734.1 cper0 CPE1028 "conserved hypothetical protein"
MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDF
IEILARNLPIVIEVIESKEKINELIELIEPMIETGTITVIDNIQVISLNKKTD
//