[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1378"

CPE1378     "conserved hypothetical protein"
            ""

OrgPattern ---------------------------------------------1---------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1-----------11111111111111-111-----------------------------------------------------------------------------------1-1-----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYVINFIRGFLMALADSVPGVSGGTIAFIMGFYNKFISSLNALTSTKKTDVSKKDAIIFL:Sequence : XXXXXXXXXXXX :SEG|44->55|tstkktdvskkd : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->254|PF04018|2e-19|36.7|221/241|DUF368 61: . . . * . .: 120 :LKLGIGWITGMVLSILFIASIFDKEIYKISSLFTGFIIFSIPIIISEDKESLKKNYGYII:Sequence : XXXXXXXXXXX :SEG|96->106|fiifsipiiis : XXXXX:SEG|116->132|ygyiiyailgiaivaai :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->254|PF04018|2e-19|36.7|221/241|DUF368 121: . . + . . .: 180 :YAILGIAIVAAITYFNPATGSAKGTSLVLNEFSLPLALYVFFAGMIAISAMVLPGISGST:Sequence :XXXXXXXXXXXX :SEG|116->132|ygyiiyailgiaivaai :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->254|PF04018|2e-19|36.7|221/241|DUF368 181: . * . . . .: 240 :LLLIFGLYAPVVNGVKEVLTFNFSYLPMLMVFGLGVVVGIITTIRLIKFLLSNYRSQMIY:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|206->227|lpmlmvfglgvvvgiittirli :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->254|PF04018|2e-19|36.7|221/241|DUF368 241: + . . . . *: 300 :FIIGLMIGSIYAVFMGPTTLEIPKAAMNLSSFNFLFFIIGGALILGLQQLKGYLEKKEKV:Sequence : XXXXXXXXXXXXXXXXX :SEG|274->290|flffiiggalilglqql :$$$$$$$$$$$$$$ :RP:PFM|12->254|PF04018|2e-19|36.7|221/241|DUF368 301: . . . . + .: 360 :SNI :Sequence