[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81084.1 cper0 CPE1378 "conserved hypothetical protein"
MYVINFIRGFLMALADSVPGVSGGTIAFIMGFYNKFISSLNALTSTKKTDVSKKDAIIFL
LKLGIGWITGMVLSILFIASIFDKEIYKISSLFTGFIIFSIPIIISEDKESLKKNYGYII
YAILGIAIVAAITYFNPATGSAKGTSLVLNEFSLPLALYVFFAGMIAISAMVLPGISGST
LLLIFGLYAPVVNGVKEVLTFNFSYLPMLMVFGLGVVVGIITTIRLIKFLLSNYRSQMIY
FIIGLMIGSIYAVFMGPTTLEIPKAAMNLSSFNFLFFIIGGALILGLQQLKGYLEKKEKV
SNI
//