[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1487"

CPE1487     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------1---1--------------------11-------------1----------------------------------------------------------------------------------------------11---111111--1-111--1--11-111---------------1-------------------------------------------------------------------------------------------21112221222121-111111121---12---22-1-1---1---------------------------21--2-------------------------------------1---2------------------------------------------------------------------------------------------------------1---------------11-----1--1------------1-----------1---------1-1-----------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKLNKFLSLVLMVLFSLSILVGCNTSKKEEAKAPEEKTSIEIVVPDGLPAISIVKMIKE:Sequence : ccEEEEEccHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|8->22|lslvlmvlfslsilv : XXXXXXXXXXX :SEG|28->38|kkeeakapeek 61: . . . * . .: 120 :KPEIMKGLDINYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGS:Sequence :HHTTTccccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEEEEEccEE:Sec Str : =================================================:RP:SCP|72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1 : =======================================================:BL:SWS|66->291|YTLA_BACSU|9e-12|25.8|217/334 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->275|PF02621|2e-13|31.4|185/253|DUF178 121: . . + . . .: 180 :LYVISSDDSVNSLEDLKGKDVYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASEL:Sequence :EEEEEEccccccGGGcTTcEEEccTTcTTTTHHHHHHTGGGTccccTTccHHHHHHHGGH:Sec Str :============================================================:RP:SCP|72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1 :============================================================:BL:SWS|66->291|YTLA_BACSU|9e-12|25.8|217/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->275|PF02621|2e-13|31.4|185/253|DUF178 181: . * . . . .: 240 :APLFIEGKAKYAVVPEPMLTQIMTKKPETKIVASLNEQWKEMSDSKMGYPQSSVIVKEDL:Sequence :HHHHccEEEcTTccTTTcHHHHTTccccGGGTTccTHHHHHHHcTTcTTcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1 :============================================================:BL:SWS|66->291|YTLA_BACSU|9e-12|25.8|217/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->275|PF02621|2e-13|31.4|185/253|DUF178 241: + . . . . *: 300 :AKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITGKKEIIAKSLERANLNYVSAL:Sequence :ccccHcEEEEETTHHHHHcccHHHHTTEEEEETHHHcTTccHHHHHHHHHHHccHHHHcc:Sec Str :============================================================:RP:SCP|72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1 :=================================================== :BL:SWS|66->291|YTLA_BACSU|9e-12|25.8|217/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|74->275|PF02621|2e-13|31.4|185/253|DUF178 301: . . . . + .: 360 :DSESEYIKYYDKIYSLEPKAIGGKKVNEEIFLQK :Sequence :HHHHcHHHHHHHHHHHHHHHcTTccTTccTT :Sec Str :=============================== :RP:SCP|72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1