[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1504"

CPE1504     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-223666665563665666424433665222343422222233--------------------1----------------1----------------------------------------------------11122222222222212221333-22-22--32321212--1211111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVNIKKLFSKENRNKTLALGLTGLVLVGGIVVFSMRKTLNVVVNGERTEIVTYKGTVQGA:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|19->32|lgltglvlvggivv : ============================:BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 61: . . . * . .: 120 :LHDNGITLAPKDKVTPSLESKISKNETITINKAVNVKVKTEDGEKEIVSAEDNVEDMLKS:Sequence : :Sec Str :============================================================:BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 121: . . + . . .: 180 :EGISFDDDDKILPDKKESLKDGMNVEVVKVDVKKVTEVHPIEFTTEVKKDESKPQTYTEV:Sequence : HHccEEEEcccccccEEEEE:Sec Str : XXXXXXXXXXXXXX :SEG|145->158|vevvkvdvkkvtev :============================================================:BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|161->208|PF07501|3e-05|45.8|48/78|G5 181: . * . . . .: 240 :LNDGQDGEKKVTRELVYENGKEVSNNVIQELVVKEPVNKEVVKGTKETQTLSRGGESINF:Sequence :EEEcccccccHHHHHHHTcGGGccHHHHH HHHHTc cHHH:Sec Str : XXXXXXXXXXXXXX :SEG|210->223|elvvkepvnkevvk :============================================================:BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|161->208|PF07501|3e-05|45.8|48/78|G5 241: + . . . . *: 300 :KKKLSVKSTAYNHPLGSAEAYTASGMHVLRDPNGYSTIAVDPSVIPLGTKLYVEGYGYAI:Sequence :HHHHHTTccccEEEEcccccccTTcccc cTTcEEEccTTTccTTcEEEEEEEEEEE:Sec Str :============================================================:RP:SCP|241->335|2g5dA1|8e-24|29.7|91/382|b.52.1.4 :============================================================:BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->336|PF06725|3e-18|71.7|60/70|3D 301: . . . . + .: 360 :AADTGGAIKGNRVDLFFNTEAEASNWGVRNLDVYILN :Sequence :EEEccTTccTTcEEEEEEEcHHHHccccEEEEEEEE :Sec Str :=================================== :RP:SCP|241->335|2g5dA1|8e-24|29.7|91/382|b.52.1.4 :===================================== :BL:SWS|33->337|YABE_BACSU|3e-37|32.2|304/437 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|277->336|PF06725|3e-18|71.7|60/70|3D