[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1838"

CPE1838     "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMILSCQKGEIMSLLIKTLVINDTNDISKLKELKDKRVKFILLNEKIFIEILRVDKKCDV:Sequence : :Sec Str : ==================================:BL:SWS|27->101|ODO1_BUCAI|3e-04|31.0|71/909 61: . . . * . .: 120 :EEKIEQLIRDRFFNYTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKDFSLTFPEL:Sequence : HHHHHHHHcccccc ccEEEEcTTEEEE EEETTEEEEEEccEEEEEcccT:Sec Str :========================================= :BL:SWS|27->101|ODO1_BUCAI|3e-04|31.0|71/909 : ============:BL:SWS|109->216|TIG_CLOPS|9e-05|35.8|81/428 121: . . + . . .: 180 :KNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKD:Sequence :TcEEEEEccccEEEEEE cccEEEEEETTcEEEEEETTTccEEEEEEcEEEEETT:Sec Str :============================================================:BL:SWS|109->216|TIG_CLOPS|9e-05|35.8|81/428 181: . * . . . .: 240 :FTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI :Sequence :ccEE :Sec Str :==================================== :BL:SWS|109->216|TIG_CLOPS|9e-05|35.8|81/428