[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81544.1 cper0 CPE1838 "hypothetical protein"
MMILSCQKGEIMSLLIKTLVINDTNDISKLKELKDKRVKFILLNEKIFIEILRVDKKCDV
EEKIEQLIRDRFFNYTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKDFSLTFPEL
KNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKD
FTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI
//