[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1854"

CPE1854     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------1111--------------- 111-11111111-1111----1--11----------1111----11-1-11---------1--11111-11111111-111111111111111111---11211121211--------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------11--------1111111111111111111111111111111111111111111111111111111111111121111111111-11111111111111111111-11111111111111111111112121111111111112-111111111111111111111111111111111111111111111111--11112-----------------------------111111222121111111111111111111111111112-1111111112-1111121211111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111--1111111-11111211211111111111-11111111111111111111112211111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111111111111--------1-1-------------------------1111111111111 --11111-21111111111-1111------------1---------11--11-1111-1111111111-1111111111111111111-121111111111-1111-12-12-11121-1-11-21111241-1111--131111-1---11-2-111134212111112111311-11F1111121111311111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQ:Sequence : cHHHHHHHHHHHHHHccEEEEEcTTccHHHHHHHHHTTccEEEEccHHHHHHHHHHHcE:Sec Str : ==========================================================:RP:SCP|3->214|1b54A|2e-28|29.4|204/230|c.1.6.2 : ==========================================:BL:SWS|19->218|Y274_AQUAE|4e-37|43.4|198/228 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->216|PF01168|5e-16|29.6|203/211|Ala_racemase_N 61: . . . * . .: 120 :DVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREE:Sequence :EEcEEEcccccGGGHHHHTTTccEEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccT:Sec Str :============================================================:RP:SCP|3->214|1b54A|2e-28|29.4|204/230|c.1.6.2 :============================================================:BL:SWS|19->218|Y274_AQUAE|4e-37|43.4|198/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->216|PF01168|5e-16|29.6|203/211|Ala_racemase_N 121: . . + . . .: 180 :QKYGILEEELDELIEAIEACNNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFK:Sequence :TcccccGGGHHHHHHHHHTcTTEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHc:Sec Str : XXXXXXXXXXXXXXX :SEG|125->139|ileeeldelieaiea : XXXXXXXXXXXX:SEG|169->180|klfcelkekkfk :============================================================:RP:SCP|3->214|1b54A|2e-28|29.4|204/230|c.1.6.2 :============================================================:BL:SWS|19->218|Y274_AQUAE|4e-37|43.4|198/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->216|PF01168|5e-16|29.6|203/211|Ala_racemase_N 181: . * . . . .: 240 :NIKMDILSMGMSGDYEIATEEGSNMVRIGQGIFGKRLYK :Sequence :cTTcTTccEEEcTTTHHHHHTTccEEEEcTTTccccTTT :Sec Str :================================== :RP:SCP|3->214|1b54A|2e-28|29.4|204/230|c.1.6.2 :====================================== :BL:SWS|19->218|Y274_AQUAE|4e-37|43.4|198/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->216|PF01168|5e-16|29.6|203/211|Ala_racemase_N