[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81560.1 cper0 CPE1854 "conserved hypothetical protein"
MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQ
DVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREE
QKYGILEEELDELIEAIEACNNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFK
NIKMDILSMGMSGDYEIATEEGSNMVRIGQGIFGKRLYK
//