[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1920"

CPE1920     "hypothetical protein"
            ""

OrgPattern -------------------------------------1------------------------------ --------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------111111111121--111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- --------------1--------------------------------------------------------1---------------------------------------1---1------------1222-11----------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA:Sequence :EEEHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHHHH:Sec Str : =======================================================:RP:SCP|6->110|1kt0A1|5e-10|22.9|105/155|a.118.8.1 : =======================================================:BL:SWS|6->104|SPAG1_HUMAN|4e-11|32.3|99/926 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->89|PF10300|6e-04|31.0|84/458|IML2 61: . . . * . .: 120 :LELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK :Sequence :HHHHHHHHccccccccHHHHHHcHHHHHHHHHHHccHHHHTTcccccccHHHHHcH :Sec Str :================================================== :RP:SCP|6->110|1kt0A1|5e-10|22.9|105/155|a.118.8.1 :============================================ :BL:SWS|6->104|SPAG1_HUMAN|4e-11|32.3|99/926 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->89|PF10300|6e-04|31.0|84/458|IML2