[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE1926"

CPE1926     "two-component sensor histidine kinase"
            ""

OrgPattern -----------------------14---21-2--11-12222417-297LG39--------------4 6HR3A45677752456655-56225755555477A737553857544356438683361155G362787B5333364444F7512455cbuV-a112--D6L6GBeGWOg--------------2213934252A5XWSRPC67k2tZkiUUEBC67121342LR9Qtv*H321221131212HB5333449AGUUVTWSTVKWSXZWQFHGFEFVXhACDQ7NG999A89lX57767666667776665675A6768863546665587655565575BCB745553366666666666555555555655542334132366aJLxTTSVWWWRUQFXUTCIJFRMG589GFF2ZWQH9846756575227AFIVTTE34344CAIJMBB8HHGFF55555555549-BCIBFFEIBDL4DFFHHFDKKHDC9ADBI83475875G84444444433223fHH11111111114911111111111121111346A2242217IEDDKHB7887HHIRBBAB59HIKAJDM-4BE9SFE56KEECC3AGK7A79H4111121243D8GwQRRB79aE5*VHGI2eccibagHDFAQAYr8D72143-----1---------8744B44FD9WKJM8VOEFBFFEEFEGDCCGEELDHN--285F8------EECBBC9EDDFEEFFDE-DGFDEEEDDEDDEEEEEEDEFG88A97FEDFEGFEEFGFGFFHECB8DCDE6-CDDEEFFCDEEE--366666678776Cg6P333223121122112BBAAC59364BIGIMGDRNQGGFLGIHHI222213312AHKJLDEEEEKLMPPDDJGKGGFGG3333--*2QQ9AFG----11-13-2-------------------------59556454441T2 --1-CC1------1D34544454656344333333334444444442655453834443656221----2--211------2222222-2514241213244367B-71B------------------------------------------------3--------------2--244N1-1-2X34B56D2-71222 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-

Master   AminoSeq   


1: . . . . + .: 60 :MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIK:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|9->32|lfiitfgiiifltlftmifqitff 61: . . . * . .: 120 :NTDSLYRALSLFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDFA:Sequence : :Sec Str 121: . . + . . .: 180 :KTLLNSNSGVTTEFKSRKYSTKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFY:Sequence : :Sec Str 181: . * . . . .: 240 :KYIILIVIVIGLILSYVFSNLISKPLVKLNKSAKKMSAMDFSEKCDIEREDEIGNLAKTL:Sequence : HHHHHHHHHHHTTccHHHHTcHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|183->194|iiliviviglil : =========================================:RP:SCP|200->252|2aswA1|2e-06|30.2|53/54|a.274.1.1 : =============================================:BL:SWS|196->255|TLPA_BACSU|6e-05|31.7|60/662 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|196->247|PF00672|3e-04|26.9|52/69|HAMP 241: + . . . . *: 300 :NFLSKNLSNALDDLKIKNKKLEEDIEKERELEKLRKDFIAGASHELKTPIGIISGYAEGI:Sequence :HGGGGccTTcHHHHHHHHHHccccTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|259->277|kkleediekereleklrkd :============ :RP:SCP|200->252|2aswA1|2e-06|30.2|53/54|a.274.1.1 : =======================:RP:SCP|278->359|1rktA2|2e-14|11.0|82/123|a.121.1.1 :=============== :BL:SWS|196->255|TLPA_BACSU|6e-05|31.7|60/662 : =======================:BL:SWS|278->500|PHOR_BACSU|7e-32|36.1|219/579 :$$$$$$$ :RP:PFM|196->247|PF00672|3e-04|26.9|52/69|HAMP : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|280->339|PF00512|3e-06|38.3|60/69|HisKA 301: . . . . + .: 360 :KDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFSLTELTEEVLV:Sequence :TccHTccccccccccTTcEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHH:Sec Str :=========================================================== :RP:SCP|278->359|1rktA2|2e-14|11.0|82/123|a.121.1.1 :============================================================:BL:SWS|278->500|PHOR_BACSU|7e-32|36.1|219/579 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|280->339|PF00512|3e-06|38.3|60/69|HisKA 361: . . . * . .: 420 :KNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV:Sequence :HHHcccccEEEEEEEcccTTcccEEEEcHHHHHHHHHHHHHHHHHHHHHTTTTccccccE:Sec Str : ==========================================:RP:SCP|379->506|1mu5A3|4e-20|12.5|128/218|d.122.1.2 :============================================================:BL:SWS|278->500|PHOR_BACSU|7e-32|36.1|219/579 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|391->495|PF02518|1e-10|32.7|104/112|HATPase_c 421: . . + . . .: 480 :EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEF:Sequence :cccEEEEEEEEEEEcccHHHHGGGGcTTTTccccccccccccccHHHHHHHHHHHTTcEE:Sec Str :============================================================:RP:SCP|379->506|1mu5A3|4e-20|12.5|128/218|d.122.1.2 :============================================================:BL:SWS|278->500|PHOR_BACSU|7e-32|36.1|219/579 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|391->495|PF02518|1e-10|32.7|104/112|HATPase_c 481: . * . . . .: 540 :GVMNTENGVKFYFTLKKSKEIDEVEEI :Sequence :EEEEETTEEEEEEEEEccTTTccccc :Sec Str :========================== :RP:SCP|379->506|1mu5A3|4e-20|12.5|128/218|d.122.1.2 :==================== :BL:SWS|278->500|PHOR_BACSU|7e-32|36.1|219/579 :$$$$$$$$$$$$$$$ :RP:PFM|391->495|PF02518|1e-10|32.7|104/112|HATPase_c