[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81632.1 cper0 CPE1926 "two-component sensor histidine kinase"
MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIK
NTDSLYRALSLFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDFA
KTLLNSNSGVTTEFKSRKYSTKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFY
KYIILIVIVIGLILSYVFSNLISKPLVKLNKSAKKMSAMDFSEKCDIEREDEIGNLAKTL
NFLSKNLSNALDDLKIKNKKLEEDIEKERELEKLRKDFIAGASHELKTPIGIISGYAEGI
KDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFSLTELTEEVLV
KNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEF
GVMNTENGVKFYFTLKKSKEIDEVEEI
//