[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2001"

CPE2001     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--1111----1--------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRYNVIDNKNNREIVLLKSFPCVWGKCAFCDYIEDNSKNTEEIIKLNKEVLSNVKGIYG:Sequence : ccTTcTTcTTccccccccccHHHHHHHHHHHTTc:Sec Str : =============================================:BL:SWS|16->136|Y550_METJA|5e-07|32.8|119/365 61: . . . * . .: 120 :VLEVINSGSVFELPKETLEEIKRIVVEKNIKKLFFEAHWCYRNRLKEIEEYFGVPIIFKT:Sequence :cEEEEEEcccGGGTTHHHHHHHHHHHTTccEEEEEcccccHHHHHHHHHTTccEEEcccc:Sec Str :============================================================:BL:SWS|16->136|Y550_METJA|5e-07|32.8|119/365 : ==:BL:SWS|119->212|FLGE_HELMU|6e-04|29.2|89/100 121: . . + . . .: 180 :GIETFDDHFRNDILNKNARFNDVEEVKKYFKSICLMVGIKGQNKDMIKRDMDILLNNFKY:Sequence :cccHHHHHHHcTTccHHHHHHHHHHHHTTEEEEccEEccTTccHHHHHHHHHHHEccEEc:Sec Str :================ :BL:SWS|16->136|Y550_METJA|5e-07|32.8|119/365 :============================================================:BL:SWS|119->212|FLGE_HELMU|6e-04|29.2|89/100 181: . * . . . .: 240 :GTVNIWTENTTSFKRDEELIKWFEKEYSFLKDNKTIEVLFENTDFGVGD :Sequence :cccTTcTTTTcccccHHHHHHHHHHHHHHcTTc :Sec Str :================================ :BL:SWS|119->212|FLGE_HELMU|6e-04|29.2|89/100