[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2025"

CPE2025     "conserved hypothetical protein"
            ""

OrgPattern 1111111111111111111111111111-111111111112111111111111111111111111111 2331311111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233333222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333334334333333321233212223323333332233333333333323333-3333333323212222222222223333233333333332222222222222333111222222222222222222222222221333332222222222222222222222222222222222222222222222222222222222111111122222233333333333333333333333322322233333333333333333333333333322222222212112222211122221211211111121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111122223121122222222112222222222222222222221222211112222211122121211112222211122222222222211111133333333--------32-------------------2------3333333333222 1111112-1-11111----------------------------------------------------------------------------------------111-131462222-2222212322518M3-52612-1411222212121242223111523212222142523334T444442223-243342223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII:Sequence :cTccccccEEccEEEEEccTTcTcGGGcccccTTccHHHHHHHHHHHHHHHHHHHHTTEE:Sec Str : ==========================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->95|PF00919|3e-12|38.7|93/97|UPF0004 61: . . . * . .: 120 :GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK:Sequence :cEEEEEEccEEEcccccEETTEEcccccTTcccccccEEEEEEEEEEEEEEEEEcccEEE:Sec Str :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->95|PF00919|3e-12|38.7|93/97|UPF0004 121: . . + . . .: 180 :VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI:Sequence :TTEEEccEEEEEETTTccEEEEEccccccccccEEEEEEEEEEEEEEHHEEEEEccEEEc:Sec Str : ##################### :PROS|146->166|PS01278|MTTASE_RADICAL|PDOC00984| : =================================================:RP:SCP|132->383|1qgoA|2e-32|11.3|231/257|c.92.1.2 :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->305|PF04055|7e-10|39.2|143/164|Radical_SAM 181: . * . . . .: 240 :RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED:Sequence :cEEEEEEEEcccccEEEEcccccTTcccccHHHHHccTTTEEEEcccccEEEETTEEEHH:Sec Str :============================================================:RP:SCP|132->383|1qgoA|2e-32|11.3|231/257|c.92.1.2 :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->305|PF04055|7e-10|39.2|143/164|Radical_SAM 241: + . . . . *: 300 :VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI:Sequence :HHHHHGGGGEEETTEEEcccccccccccccEEccccccTccHHHHHHHHHHTTccccccc:Sec Str :============================================================:RP:SCP|132->383|1qgoA|2e-32|11.3|231/257|c.92.1.2 :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->305|PF04055|7e-10|39.2|143/164|Radical_SAM 301: . . . . + .: 360 :VGFPGETDEEFEETYEFLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE:Sequence :cccccccHHHHHHHHHHHHHHTccccEEEcccccTTccHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|306->317|etdeefeetyef :============================================================:RP:SCP|132->383|1qgoA|2e-32|11.3|231/257|c.92.1.2 :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 :$$$$$ :RP:PFM|146->305|PF04055|7e-10|39.2|143/164|Radical_SAM 361: . . . * . .: 420 :LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI:Sequence :cHHHHHHHHTccTTTTcHHHHTTcGEEEcccHHHHHHHHHHHHHHHHTTcHHHHHHHccH:Sec Str :======================= :RP:SCP|132->383|1qgoA|2e-32|11.3|231/257|c.92.1.2 : =======================================================:RP:SCP|366->433|1yezA1|4e-04|19.0|63/68|b.40.4.12 :============================================================:BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451 421: . . + . . .: 480 :NSFEGEVAEGEIVL :Sequence :H :Sec Str :============= :RP:SCP|366->433|1yezA1|4e-04|19.0|63/68|b.40.4.12 :============= :BL:SWS|3->433|YQEV_BACSU|e-102|43.1|429/451