[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81731.1 cper0 CPE2025 "conserved hypothetical protein"
MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII
GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK
VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI
RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED
VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI
VGFPGETDEEFEETYEFLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE
LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI
NSFEGEVAEGEIVL
//