[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2125"

CPE2125     "conserved hypothetical protein"
NADD_CLOPE  "RecName: Full=Probable nicotinate-nucleotide adenylyltransferase;         EC=2.7.7.18;AltName: Full=Deamido-NAD(+) pyrophosphorylase;AltName: Full=Deamido-NAD(+) diphosphorylase;AltName: Full=Nicotinate mononucleotide adenylyltransferase;         Short=NaMN adenylyltransferase;"

OrgPattern -------------------------------------------------------------------- -111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------111111111111111111111-------11-----------1111----------------111111111111111111111111111111111112111111111221111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111-1111111----1--------------------------------1--1-111--111-111--111-------11111111111--------11-------1-------------------11---11111-11111-111111111111111111111111111-1-----11--1111111111111111111111111111111111111111111111----1111111--1111-11-11111111-11-1111-1111111111111111111111111111--11111--11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--1111111111111111------------------------11111111111111111111---------1--------------111---1-1-----1111------11111111111----1-11111111111111111111111111111111 -1----------------------------------------------------------------------------------------------------------1----------------------------------------------------1------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMV:Sequence :ccEEEEEEEccccccHHHHHHHHHHHHHTTccEEEEEEccccTTcccTTcccHHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->200|1k4kA|1e-45|29.3|198/213|c.26.1.3 :============================================================:BL:SWS|1->202|NADD_CLOPE|e-118|100.0|202/202 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->173|PF01467|3e-13|36.2|141/145|CTP_transf_2 61: . . . * . .: 120 :KKAIEPYSFFSINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNIN:Sequence :HHHHTTcTTEEEccGGGcccccccHHHHHHHHHHHcTTcEEEEEEEHHHHHHGGGcTTHH:Sec Str :============================================================:RP:SCP|2->200|1k4kA|1e-45|29.3|198/213|c.26.1.3 :============================================================:BL:SWS|1->202|NADD_CLOPE|e-118|100.0|202/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->173|PF01467|3e-13|36.2|141/145|CTP_transf_2 121: . . + . . .: 180 :EIFKFSNLVVFNRPGFDKNDLLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLE:Sequence :HHHHHcEEEEEccTTcccGGGTTHHTTcccccccccEEEccccccccHHHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|2->200|1k4kA|1e-45|29.3|198/213|c.26.1.3 :============================================================:BL:SWS|1->202|NADD_CLOPE|e-118|100.0|202/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->173|PF01467|3e-13|36.2|141/145|CTP_transf_2 181: . * . . . .: 240 :VKFFLPPGVVDIIDKYNLYRRE :Sequence :cTTTccHHHHHHHHHHTTTcHH :Sec Str :==================== :RP:SCP|2->200|1k4kA|1e-45|29.3|198/213|c.26.1.3 :====================== :BL:SWS|1->202|NADD_CLOPE|e-118|100.0|202/202