[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2216"

CPE2216     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111-11111111111111111111111111-1-111111111-111-----------------------------------------------11111111111111111111111--1111---------111-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTRLTLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKV:Sequence : TTTcEEEEEEcccccccccEEEEEEEEcccEEEEEcTTcccccc:Sec Str : =======================================================:BL:SWS|6->76|VEG_BACSU|7e-17|46.5|71/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->76|PF06257|1e-14|55.7|70/76|DUF1021 61: . . . * . .: 120 :TYSYSDVLTKTVQLDFVG :Sequence :EEEHHHHHTT :Sec Str :================ :BL:SWS|6->76|VEG_BACSU|7e-17|46.5|71/100 :$$$$$$$$$$$$$$$$ :RP:PFM|7->76|PF06257|1e-14|55.7|70/76|DUF1021