[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81922.1 cper0 CPE2216 "conserved hypothetical protein"
MSTRLTLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKV
TYSYSDVLTKTVQLDFVG
//