[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2334"

CPE2334     "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------11-111---------------111111---111111111111111-1111111111111111111----------------------------------------------------------------------11-1111111111111-1111111-1111111-11111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNGVQSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKT:Sequence : GGGccHHHHHHccccccTTccHHHHHHHHHHHccTHHHHHHHHHHHHHHHHTccc:Sec Str : ======================================================:BL:SWS|7->98|YERC_BACSU|3e-30|63.0|92/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->96|PF01371|2e-20|59.0|83/88|Trp_repressor 61: . . . * . .: 120 :YTEIAEETKASTATISRVNRCLNYGADGYNNILNRLDEK :Sequence :cccHHHHHTccHHHHHHHHHHHHHccccHHHHHHHTTTc :Sec Str :====================================== :BL:SWS|7->98|YERC_BACSU|3e-30|63.0|92/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->96|PF01371|2e-20|59.0|83/88|Trp_repressor