[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB82040.1 cper0 CPE2334 "conserved hypothetical protein"
MNGVQSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKT
YTEIAEETKASTATISRVNRCLNYGADGYNNILNRLDEK
//