[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE2627"

CPE2627     "probable transcriptional regulator"
            ""

OrgPattern -------------------------------------------------------------------- -21283132231--23311-14--2711111263431686311-132--122523--3--21123553562-------3---4-------1--------------1-111-----------------------------1----------11----------------1--------------432-----1375555556625555556666485553573546799A98141111111111111111--11965238238386833645385342211115333333333333333334444344444443355111555425-492222222425381134443121-2----67-2--41-11211113-1-322--------232--1---1144444443447---2--2-213--844345355678311111322114332--------2--1--11-------------------------------1-1-266248888884656677A866664597BA9851155312212323354322111142----------111-12---11-----3------1-11----1----------------------------1143112-114131111-11111111111111------1------54531525554542466-55565326565444454446663421-5345454555455555454334452-333243333344---1-----------435---1-----------5545421-12-16656444523324-344---------122212221234422-122221222-------1-------------------------------------------231-15-1-1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------9-----------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERK:Sequence :HccccccccHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHT:Sec Str : ===================================================:RP:SCP|10->75|1e2xA1|2e-19|31.8|66/73|a.4.5.6 : ====================================================:BL:SWS|9->236|YBGA_BACSU|2e-39|38.7|225/235 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->73|PF00392|1e-08|49.2|61/64|GntR 61: . . . * . .: 120 :EYVYKVHGKGTFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLK:Sequence :TcEEEcccEEEccccEEEcccccccccHHHHHcccTTccEEEEEEEEEEEccHHHHHHHT:Sec Str :=============== :RP:SCP|10->75|1e2xA1|2e-19|31.8|66/73|a.4.5.6 : =====================================:RP:SCP|84->238|2ooiA1|4e-33|13.6|154/157|d.190.1.2 :============================================================:BL:SWS|9->236|YBGA_BACSU|2e-39|38.7|225/235 :$$$$$$$$$$$$$ :RP:PFM|13->73|PF00392|1e-08|49.2|61/64|GntR : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->232|PF07702|2e-21|37.2|137/141|UTRA 121: . . + . . .: 180 :VEENSLVYKIVRLRIADEVPMMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTK:Sequence :ccTTcEEEEEEEEEEEEETTEEEEEEEEEHHHHTTccTTcTTccTTTTHHHHHTTccccE:Sec Str :============================================================:RP:SCP|84->238|2ooiA1|4e-33|13.6|154/157|d.190.1.2 :============================================================:BL:SWS|9->236|YBGA_BACSU|2e-39|38.7|225/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->232|PF07702|2e-21|37.2|137/141|UTRA 181: . * . . . .: 240 :AKESFKPILISKSDSKLLNVEDGTAAMRIERVTFENERVIEYTVSVSRGDKFEYTVVLEE:Sequence :EEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEETTEEEEEEEEEEETTTEEEEcccc :Sec Str :========================================================== :RP:SCP|84->238|2ooiA1|4e-33|13.6|154/157|d.190.1.2 :======================================================== :BL:SWS|9->236|YBGA_BACSU|2e-39|38.7|225/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|96->232|PF07702|2e-21|37.2|137/141|UTRA 241: + . . . . *: 300 :D :Sequence : :Sec Str