[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:asrA.1"

asrA        "anaerobic sulfite reductase subunit A"
            ""

OrgPattern -----------------------------1------------------1-----221-122-111--- ------------------------11-------111-11-1-1-------------------------------------11---11-----1--------------------------------22222111211-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112-1--1221-1------11--3211-11211----1-1----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11--212111111-2221113-2-----111-------------------------111-----------------------------------1----------2----------------1-----------------------11-1111111111111-------------------------------1111------------------------------1------------------1---------------------------------------1--------------------------------------------1--------2-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDF:Sequence : :Sec Str : ================:RP:SCP|45->183|1agmA|8e-05|5.8|139/470|a.102.1.1 :============================================================:BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347 61: . . . * . .: 120 :SYKEVLLPITQTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYY:Sequence : :Sec Str :============================================================:RP:SCP|45->183|1agmA|8e-05|5.8|139/470|a.102.1.1 :============================================================:BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347 121: . . + . . .: 180 :KKLREKAKFIVMGCENSFDNCFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEA:Sequence : :Sec Str :============================================================:RP:SCP|45->183|1agmA|8e-05|5.8|139/470|a.102.1.1 :============================================================:BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347 181: . * . . . .: 240 :VESNKEEVSPKFVEENETKVEVPEGIDLNIIKSTVWNEYSERCIACGRCNFVCPTCTCFT:Sequence : GGGTTTccHHHHcccccEEE:Sec Str : ############ :PROS|223->234|PS00198|4FE4S_FER_1|PDOC00176| :=== :RP:SCP|45->183|1agmA|8e-05|5.8|139/470|a.102.1.1 : ====================:RP:SCP|221->333|1nekB1|4e-06|15.7|89/132|a.1.2.1 :============================================================:BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347 : $$$$:RP:PFM|237->273|PF05577|4e-04|37.8|37/411|Peptidase_S28 241: + . . . . *: 300 :MQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDKGQRMRFKVMHKVYDYKKRWG:Sequence :ccccEEEcTTTcccccccTTTcTTccEEEG HHHHHHTcTTGGccGGGTHHHHHHHHH:Sec Str :============================================================:RP:SCP|221->333|1nekB1|4e-06|15.7|89/132|a.1.2.1 :============================================================:BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|237->273|PF05577|4e-04|37.8|37/411|Peptidase_S28 301: . . . . + .: 360 :YHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNA :Sequence :HTTcccccccccccTTHHHHTTcccGGGG :Sec Str : ############ :PROS|304->315|PS00198|4FE4S_FER_1|PDOC00176| :================================= :RP:SCP|221->333|1nekB1|4e-06|15.7|89/132|a.1.2.1 :================================= :BL:SWS|1->333|ASRA_SALTY|1e-77|42.5|332/347