[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81146.1 cper0 asrA.1 "anaerobic sulfite reductase subunit A"
MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDF
SYKEVLLPITQTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYY
KKLREKAKFIVMGCENSFDNCFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEA
VESNKEEVSPKFVEENETKVEVPEGIDLNIIKSTVWNEYSERCIACGRCNFVCPTCTCFT
MQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDKGQRMRFKVMHKVYDYKKRWG
YHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNA
//