[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:asrB.1"

asrB        "anaerobic sulfite reductase subunit B"
            ""

OrgPattern -----------------------1-----1--11111111111-211222111-33212331221-11 -1----------------------11-------111-11-1-1----------------------------1--------22--1221111-31-1-----------------------------22232111222-----222-1---1-----------------1--------------------111--1--------------1--1111-------1--111111---------------------------------------------111-------211------------------------1---------21-2544444447462222344313112-1111--4211-2122211111-2-1--------1-1-----2-111----------2--------------11---1-----------------------------------------------------------------------1111--------1111111-111111----21-1-23-1-----2----11-2111----------1---2-1212212121111-2322224-2-----111-------------------------221--11--1--1-------1--------------1-12---------------------------1------------------1----1111111111111111-------------------------------1111-1----------------------------1------------------2-------------------------------------1-1111------------211------------------1------322-11211-2-- -----1--21-----12222--111---1-1-11-11111111---22111222--1112212-2221-3-113311111111111-1-1--2152----111211-----1---1--------------------1-----------------------------------------18-----1-13221-133321 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDY:Sequence : TccEEEEEEHHHHTTTTTccHHHHHHHcTTccccHHHHHHHccccccEEEEcTTTcTTE:Sec Str : =======================================================:RP:SCP|6->94|1qfjA1|2e-12|22.1|86/91|b.43.4.2 : ======================================================:BL:SWS|7->263|ASRB_SALTY|1e-68|43.6|257/272 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->92|PF00970|4e-05|34.9|83/99|FAD_binding_6 61: . . . * . .: 120 :VELTIRRVGVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIV:Sequence :EEEEEEccEEEcTTccEEEcccEEEEEEEccccccccccTTccEEEEEEGGGGHHHHHHH:Sec Str :================================== :RP:SCP|6->94|1qfjA1|2e-12|22.1|86/91|b.43.4.2 : ================================:RP:SCP|89->257|1ep1B2|2e-21|21.3|150/160|c.25.1.3 :============================================================:BL:SWS|7->263|ASRB_SALTY|1e-68|43.6|257/272 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->92|PF00970|4e-05|34.9|83/99|FAD_binding_6 : $$$$$$$$$$$$$$$:RP:PFM|106->205|PF00175|1e-09|31.6|95/107|NAD_binding_1 121: . . + . . .: 180 :DYFSQNPKDAESFTLISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTK:Sequence :HHHHHHHHTTcEEEEEEEccTTTccTTHHHHHHHHHEEEEEETTcccccccHHHHHHHTH:Sec Str :============================================================:RP:SCP|89->257|1ep1B2|2e-21|21.3|150/160|c.25.1.3 :============================================================:BL:SWS|7->263|ASRB_SALTY|1e-68|43.6|257/272 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|106->205|PF00175|1e-09|31.6|95/107|NAD_binding_1 181: . * . . . .: 240 :YIPELEIKDMDNVQVIVVGPPMMMKFTVLEFLKRGIKEENIWISQERKMCCGLGKCGHCK:Sequence :HHHHHHHHHcTccEEEEEEETTTHHHHHHHHHHHHHHHTTcHHHHHHHHHHccccccTTc:Sec Str :============================================================:RP:SCP|89->257|1ep1B2|2e-21|21.3|150/160|c.25.1.3 :============================================================:BL:SWS|7->263|ASRB_SALTY|1e-68|43.6|257/272 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|106->205|PF00175|1e-09|31.6|95/107|NAD_binding_1 : $$$$$$$$$$$$$$$:RP:PFM|226->254|PF10418|4e-06|58.6|29/38|DHODB_Fe-S_bind 241: + . . . . *: 300 :IDDTYICLDGPVFNYTKGKLLID :Sequence :cTTccTTTTccEE :Sec Str :================= :RP:SCP|89->257|1ep1B2|2e-21|21.3|150/160|c.25.1.3 :======================= :BL:SWS|7->263|ASRB_SALTY|1e-68|43.6|257/272 :$$$$$$$$$$$$$$ :RP:PFM|226->254|PF10418|4e-06|58.6|29/38|DHODB_Fe-S_bind