[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81145.1 cper0 asrB.1 "anaerobic sulfite reductase subunit B"
MHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDY
VELTIRRVGVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIV
DYFSQNPKDAESFTLISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTK
YIPELEIKDMDNVQVIVVGPPMMMKFTVLEFLKRGIKEENIWISQERKMCCGLGKCGHCK
IDDTYICLDGPVFNYTKGKLLID
//