[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:asrC.1"

asrC        "anaerobic sulfite reductase subunit C"
            ""

OrgPattern -----------------1322111---------112221----24121-21112-------------- --------------------------------------1------------------------------------------------------1-----------1---------------------1----11----------1-111-11-11--1-1---2---111----1-----1---1------------------------------------------------1111111111111111111-----------------------------------------------------------------------1-1132222222223-2112221221---11--33112---2311-1--1---1111----------111-------------------------1----111111-1111--11-11-----1--------------11---------------------------------111-----1-------1111----111111--------1---111---11121-111--1-----------1--1-111-111--111--111-1111--------1---------------------------1---------------------------------------------------------------1-----------------------1111111111111111-------------------------------------1---------------------------1-1111--1-1----1-----------------------------------------11--------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111-1-------11----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTR:Sequence : ccTTEEEEEcccGGGEEEHHHHHHHHHHHHTTGGccEEEcTT:Sec Str : =======================================:RP:SCP|22->81|1zj8A2|1e-17|28.3|60/152|d.58.36.1 :============================================================:BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->76|PF03460|6e-11|40.0|55/67|NIR_SIR_ferr 61: . . . * . .: 120 :QGFEIPGIDMKDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANY:Sequence :ccEEEEEEcGGGHHHHHHGHHHHHHHHHTTTcccTTcccccHcccccccTTTTTcTTccc:Sec Str :===================== :RP:SCP|22->81|1zj8A2|1e-17|28.3|60/152|d.58.36.1 : =================:RP:SCP|104->213|2akjA4|7e-14|12.7|110/171|d.134.1.1 :============================================================:BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337 :$$$$$$$$$$$$$$$$ :RP:PFM|22->76|PF03460|6e-11|40.0|55/67|NIR_SIR_ferr : $$$$$$$$$$$$$$$$$:RP:PFM|104->163|PF01077|1e-08|45.8|59/153|NIR_SIR 121: . . + . . .: 180 :NTTNFAKKIEKAIFPNDLHFKIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGAC:Sequence :ccHHHHHHHHHHHTTTTTcccEEEcccTTcTTcGGGccEEEEEEEccccEEEEEEEccEE:Sec Str : ################# :PROS|145->161|PS00365|NIR_SIR|PDOC00314| :============================================================:RP:SCP|104->213|2akjA4|7e-14|12.7|110/171|d.134.1.1 :============================================================:BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|104->163|PF01077|1e-08|45.8|59/153|NIR_SIR 181: . * . . . .: 240 :VRACKKKATGALSFENFKVVRDGSKCIGCGECVMNCPTNAWTRSKEKYYRLAIMGRTGKK:Sequence :ccEEccEEEEEEEEGGGHHHHHHHHHHHHHHHcccccGGGcEETTETTTccHHHHHHHHH:Sec Str : ############ :PROS|206->217|PS00198|4FE4S_FER_1|PDOC00176| :================================= :RP:SCP|104->213|2akjA4|7e-14|12.7|110/171|d.134.1.1 :============================================================:BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337 : $$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|199->220|PF00037|2e-04|63.6|22/24|Fer4 241: + . . . . *: 300 :NPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGKEHIGYIIDRTGFMEFKKWAL:Sequence :HHHHHcccEEEcTTccEEEcGGGHHHHHHHHHHHHHHHHHHHTTccccccccccccEEHH:Sec Str :============================================================:BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337 301: . . . . + .: 360 :EGVTLSEKALMKNNVYWSGIHYTNGF :Sequence :HTcccc :Sec Str :================== :BL:SWS|1->318|ASRC_SALTY|2e-80|44.4|313/337