[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81144.1 cper0 asrC.1 "anaerobic sulfite reductase subunit C"
MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTR
QGFEIPGIDMKDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANY
NTTNFAKKIEKAIFPNDLHFKIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGAC
VRACKKKATGALSFENFKVVRDGSKCIGCGECVMNCPTNAWTRSKEKYYRLAIMGRTGKK
NPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGKEHIGYIIDRTGFMEFKKWAL
EGVTLSEKALMKNNVYWSGIHYTNGF
//