[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:ctrA"

ctrA        "CTP synthase"
PYRG_CLOPS  "RecName: Full=CTP synthase;         EC=6.3.4.2;AltName: Full=UTP--ammonia ligase;AltName: Full=CTP synthetase;"

OrgPattern 11111111111111111111111111111111111111111111111111111111111111111-11 12211--111111-11111-1111111111111111111112111111111111111111111111112111111111111111111111111111---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111-1111111111111-1111111-1-111111111111111111111-1111111111111111111111111111111111111-11111111111122211111111111111111111111111111111111111111111111111--1-11-11111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111-1111111-11122211221111111111-11111111111111111111321111111111111111111112111111111111111111111111111111111111111111111111111111111111111111222212221111112221111111111111111111111111111111111111111111111111111111111111111-111111-111121-1-1111111111111121 1111111-211211111111111111111111111111113111111111112111111111111111-1111112222211111111-121111111111-1212213113223323222222842427I3-3222222322222222242122322313812112211B11311111G1111134571541221112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHG:Sequence : cccEEEEEcccccccccHHHHHHHHHHHHHTTTccEEEEEEEcccccccccccTTTcc:Sec Str : ========================================================:RP:SCP|5->270|1s1mA2|1e-80|58.0|264/266|c.37.1.10 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->276|PF06418|e-106|65.8|272/274|CTP_synth_N 61: . . . * . .: 120 :EVFVTDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPH:Sequence :ccccccccccccHcTTcGGGGccTcccGGGEEEHHHHHHHHHHHHHTTTTTTccccTTTH:Sec Str :============================================================:RP:SCP|5->270|1s1mA2|1e-80|58.0|264/266|c.37.1.10 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->276|PF06418|e-106|65.8|272/274|CTP_synth_N 121: . . + . . .: 180 :ITNAIKDRVHRVGKERDVDVVITEIGGTIGDIESLPFLEAIRQIKYDVGKENVCFIHVTL:Sequence :HHHHHHHHHHHHTccccEEEEEEcccTTcTTccTHHHHHHHHHHHHHccTTTEEEccccE:Sec Str : XXXXXXXXXXXXXXXX :SEG|138->153|vdvviteiggtigdie :============================================================:RP:SCP|5->270|1s1mA2|1e-80|58.0|264/266|c.37.1.10 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->276|PF06418|e-106|65.8|272/274|CTP_synth_N 181: . * . . . .: 240 :VPYLGKAGELKTKPTQHSVKELRSIGIQPDIIVCRSEKELSEDIKKKIGLFCNIDASEVI:Sequence :EcccTTTcccccHHHHHHHHHHHHTcccccccccEEcccccHHHHHHHHTTTTccccccc:Sec Str :============================================================:RP:SCP|5->270|1s1mA2|1e-80|58.0|264/266|c.37.1.10 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->276|PF06418|e-106|65.8|272/274|CTP_synth_N 241: + . . . . *: 300 :QNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEWIDMVHRITHLTHTTKIALVG:Sequence :cccccccGGGHHHHHHTTTHHHHHHHHTTccHHHHHHHHHHccccTTcccHHHHcccccE:Sec Str :============================== :RP:SCP|5->270|1s1mA2|1e-80|58.0|264/266|c.37.1.10 : ======:RP:SCP|295->535|1s1mA1|e-105|52.5|240/248|c.23.16.1 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->276|PF06418|e-106|65.8|272/274|CTP_synth_N 301: . . . . + .: 360 :KYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGD:Sequence :EEccccccTTTcccccccGGGccEEEEEEEccccHHHTccHHHHHTTcccEEEEcccccc:Sec Str :============================================================:RP:SCP|295->535|1s1mA1|e-105|52.5|240/248|c.23.16.1 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|305->527|PF00117|3e-23|43.6|179/185|GATase 361: . . . * . .: 420 :RGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL:Sequence :TTcHHHHHHHHHHTTccccEEEEEHHHHHHHHHHTccEEEEEEEEEEEEEEEEETEEEEE:Sec Str :============================================================:RP:SCP|295->535|1s1mA1|e-105|52.5|240/248|c.23.16.1 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|305->527|PF00117|3e-23|43.6|179/185|GATase 421: . . + . . .: 480 :MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESG:Sequence :EEcccEEEEccEEEEEEEEEEETTEEEEEEETTTTEEEEEEEEEEEEEcGGGccTEccTT:Sec Str :============================================================:RP:SCP|295->535|1s1mA1|e-105|52.5|240/248|c.23.16.1 :============================================================:BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|305->527|PF00117|3e-23|43.6|179/185|GATase 481: . * . . . .: 540 :LTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNNK :Sequence :EEEEEEEcccccEEEEEEccccEETEEcccTTccccccTTTHHHHHHHHHHHHHH :Sec Str :======================================================= :RP:SCP|295->535|1s1mA1|e-105|52.5|240/248|c.23.16.1 :======================================================= :BL:SWS|1->535|PYRG_CLOPS|0.0|100.0|535/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|305->527|PF00117|3e-23|43.6|179/185|GATase