[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:ddlA"

ddlA        "D-alanine-D-alanine ligase"
DDLA_CLOPE  "RecName: Full=D-alanine--D-alanine ligase A;         EC=6.3.2.4;AltName: Full=D-alanylalanine synthetase A;AltName: Full=D-Ala-D-Ala ligase A;"

OrgPattern ----------------------------------------------1-----1--------------1 111-311111121111111-11111111111111111111211312112331111111112232222121211111112221212211111111112--111111111211111111111111111111111112111111111111211112111111111111111111111111111111111111111111111122212222221111112221112111111111331111111111111111111121111111111111111111111111111111111111111121111111111111111111111111111421111111111111211122132111111112211111111222111111-211111111114221111111122222222221-111111111211211123222211111111131111111111111111111111111--------111111111111111111111111111111111111111111112111111211111111111111222111111111111211111111111111112111121111111111111111222233221111111111111111111111111111111111111212111111122111111111-1111111----22112212222222222-2222222222222122222222111112221222222222212222222221121111111111111111111111111122111111111111111111111111111122221212121331222111-111111222211111111112212222222111111112211111111111111--------------------------1212213112121 -----------------------2-21--------------------------------111-----------------------------------------------------------------------------------------------------1---------1----1------2--2--1------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLAL:Sequence :EEEEEEEEcccTTHHHHHHHHHHHHHHccTTTEEEEEEEEcTccccEEEcTTccEEEEEE:Sec Str : ===========================================================:RP:SCP|2->92|1ehiA1|3e-24|31.9|91/132|c.30.1.2 :============================================================:BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->83|PF01820|6e-16|50.6|83/108|Dala_Dala_lig_N 61: . . . * . .: 120 :HGKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDE:Sequence :ccHHHHccHHHHHHHHTTcccccccHHHHHHHHcHHHHHHHHHHTTcccccEEEEETTcc:Sec Str :############ :PROS|61->72|PS00843|DALA_DALA_LIGASE_1|PDOC00659| :================================ :RP:SCP|2->92|1ehiA1|3e-24|31.9|91/132|c.30.1.2 : ===========================:RP:SCP|94->297|1e4eA2|1e-44|29.9|201/211|d.142.1.1 :============================================================:BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->83|PF01820|6e-16|50.6|83/108|Dala_Dala_lig_N : $$$$$$$$$$$$$$$$$$$$:RP:PFM|101->293|PF07478|6e-40|43.0|193/199|Dala_Dala_lig_C 121: . . + . . .: 180 :IDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEI:Sequence :HHHHHHHHHcccEEEEEccccccTTcEEEccGGGHHHHHHHHTTTccEEEEEEccccEEE:Sec Str :============================================================:RP:SCP|94->297|1e4eA2|1e-44|29.9|201/211|d.142.1.1 :============================================================:BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|101->293|PF07478|6e-40|43.0|193/199|Dala_Dala_lig_C 181: . * . . . .: 240 :TCPIIDGKMLPVLAIKPKGKFFDIASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLK:Sequence :EEEEEEccccEEEEEEEEcccccEEEEEEEEcccEEcccccHHHHHHHHHHHHHHHHHHT:Sec Str : ##:PROS|239->266|PS00844|DALA_DALA_LIGASE_2|PDOC00659| :============================================================:RP:SCP|94->297|1e4eA2|1e-44|29.9|201/211|d.142.1.1 :============================================================:BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|101->293|PF07478|6e-40|43.0|193/199|Dala_Dala_lig_C 241: + . . . . *: 300 :CDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLKVNR:Sequence :cccEEEEEEEcTTccEEEEEEEccccccTTcHHHHHHHTTTccHHHHHHHHHHHHHc :Sec Str :########################## :PROS|239->266|PS00844|DALA_DALA_LIGASE_2|PDOC00659| :========================================================= :RP:SCP|94->297|1e4eA2|1e-44|29.9|201/211|d.142.1.1 :============================================================:BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|101->293|PF07478|6e-40|43.0|193/199|Dala_Dala_lig_C 301: . . . . + .: 360 :E :Sequence : :Sec Str := :BL:SWS|1->301|DDLA_CLOPE|e-171|100.0|301/301