[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:etfB.1"

etfB        "electron transfer flavoprotein beta-subunit"
            ""

OrgPattern 22----2222222222-22312212112-111-----------------------------2322--- 1231211111111111111-1111111111111111112211111--11----11-12--112-1111121---------21------11111122---111111111-1---------------1111111111111122---11-------11-----------1-----------------1-11--11211111111111111111111111111131111------21----------------------1-------------------------------------------------------------------1532444444443431422422214-1-1-12-973463-141--11-2-12-1---11111222221112222211111111111-1121131112113112334335232211111111111111111111112211322-----------------------------1121112---21112211111111251111112441112111214-22221--1-111-11111----------1-115422----------7371825--11211114-------------------------1111-1111121-1111111311112132111-----1-------1-1-1--2222222221-2222222222222222221-------13221333332313113--112221-----------------1111111111-1-11---------------11111111114111111111111111112-------------------11---11--1--1111111--11111111----------1-------------------------11111121111-- ----111-111---1-111111111111111111111111-11-1111111111-1111111111111-11111111111111111-1-1211-111-11111112-1-12111--1----11-11-3-252--12-11-1111-----11--1---111111-111---211111-1-----1-1112-111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVIS:Sequence :cEEEEEccEEEcTccccccTTccccccTTccEEEcHHHHHHHHHHHHHHHTTccEEEEEE:Sec Str :============================================================:RP:SCP|1->232|1efpB|7e-50|24.1|224/246|c.26.2.3 :============================================================:BL:SWS|1->256|ETFB_CLOTS|2e-56|45.5|253/260 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->178|PF01012|6e-17|37.4|139/157|ETF 61: . . . * . .: 120 :MGPPQAKAVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQT:Sequence :EEcTTHHHHHHHHHHHTccEEEEEEccHHHHccHHHHHHHHHHHHHHHTTccEEEEEccc:Sec Str :============================================================:RP:SCP|1->232|1efpB|7e-50|24.1|224/246|c.26.2.3 :============================================================:BL:SWS|1->256|ETFB_CLOTS|2e-56|45.5|253/260 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->178|PF01012|6e-17|37.4|139/157|ETF 121: . . + . . .: 180 :TDGDTAQVGPEMAEYLGIPHVANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDK:Sequence :TTTccccHHHHHHHHHTccEEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcT:Sec Str :============================================================:RP:SCP|1->232|1efpB|7e-50|24.1|224/246|c.26.2.3 :============================================================:BL:SWS|1->256|ETFB_CLOTS|2e-56|45.5|253/260 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|34->178|PF01012|6e-17|37.4|139/157|ETF 181: . * . . . .: 240 :DIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYGLNGSPTQVERIFPPSNNDDHEI:Sequence :TccccccccHHHHHHHTTccEEEEcGGGGTcccGGGccGGcccccccccccccccccccc:Sec Str :==================================================== :RP:SCP|1->232|1efpB|7e-50|24.1|224/246|c.26.2.3 :============================================================:BL:SWS|1->256|ETFB_CLOTS|2e-56|45.5|253/260 241: + . . . . *: 300 :WTGDSSELSERMEDKLRELKFI :Sequence :ccccHHHHHHHHHHHHHHTTcc :Sec Str :================ :BL:SWS|1->256|ETFB_CLOTS|2e-56|45.5|253/260