[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB80017.1 cper0 etfB.1 "electron transfer flavoprotein beta-subunit"
MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVIS
MGPPQAKAVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQT
TDGDTAQVGPEMAEYLGIPHVANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDK
DIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYGLNGSPTQVERIFPPSNNDDHEI
WTGDSSELSERMEDKLRELKFI
//