[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:fruR"

fruR        "probable transcriptional regulator"
            ""

OrgPattern ------------------------2--1---------------------------------------- 33--8322334111-------3---5------322212221--1611-12216461-4--2135626555311111112---1--------1--------13--14-6-B--------------------------22211----------------------------1-------------321--22-31433333334243333375442434411123236666666A2222222222222224322342-1261-32255--771411--3422233333344444444444444444444444444434221333551177332344354413--244222-3-1121----1--1--42225222--12--------1-113---1311122222222224-1111112218--8665454767552----3225245322111111113111---3-------------------------------1---111113445432333344683333134252232--1211-1111-1323-------211111111--------2---12--1---1-------11-----1-----------------------------4392-1111122111111122211111111-------------7487553A98BABBBAA-9BAA9A9A9A9CA9AABA4AAB56432B8CBCBCBBABBABBBA887AA982-766666556666---------------115333737223225775----------2-22122432222222455----------333633333532561111111----------4---------------------1---2-1-----121-------41--13111--- -------------2------------------------------------------------------------------------------------------------------------------------------------------------1----1------4---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLSEKRHEIILNLLKLKGFVSLTELLEATESSESTIRRDLSYLESINLLKRVHGGAKSLA:Sequence :ccEEEEEEEcTTccEEEEEEETTTTEEEEEETTEEEEEcTTcccGGGccccGGGccEcEE:Sec Str : XXXXXXXXXXXXXXX :SEG|21->35|sltelleatessest : ################################### :PROS|6->40|PS00894|HTH_DEOR_1|PDOC00696| : =================================================== :RP:SCP|6->56|1lvaA4|2e-06|13.7|51/60|a.4.5.35 :============================================================:BL:SWS|1->246|FRUR_BACSU|1e-54|45.9|246/251 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->56|PF08220|3e-06|47.1|51/56|HTH_DeoR 61: . . . * . .: 120 :NVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVS:Sequence :EccccccTTTcTTHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccTTccEE:Sec Str : =============================================:RP:SCP|76->228|1poiB|1e-26|13.7|153/260|c.124.1.3 :============================================================:BL:SWS|1->246|FRUR_BACSU|1e-54|45.9|246/251 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|76->223|PF00455|3e-30|47.3|148/157|DeoR 121: . . + . . .: 180 :NGLSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGL:Sequence :TTTEEEEcccccGEEEEEccccccccGGGcHHHHHHHHHHHHTcEEccccccccccHcHH:Sec Str :============================================================:RP:SCP|76->228|1poiB|1e-26|13.7|153/260|c.124.1.3 :============================================================:BL:SWS|1->246|FRUR_BACSU|1e-54|45.9|246/251 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|76->223|PF00455|3e-30|47.3|148/157|DeoR 181: . * . . . .: 240 :TTPDTEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPKDNTYDKK:Sequence :HHHHHHcHHHHHHHHHHHTccEEEEccEEHHHHHHHTTccHHHHHHHHHTTccEEETTEE:Sec Str :================================================ :RP:SCP|76->228|1poiB|1e-26|13.7|153/260|c.124.1.3 :============================================================:BL:SWS|1->246|FRUR_BACSU|1e-54|45.9|246/251 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|76->223|PF00455|3e-30|47.3|148/157|DeoR 241: + . . . . *: 300 :TDIKVVDI :Sequence :EcTTccEE :Sec Str :====== :BL:SWS|1->246|FRUR_BACSU|1e-54|45.9|246/251