[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:hemA"

hemA        "glutamyl-tRNA reductase"
HEM1_CLOPE  "RecName: Full=Glutamyl-tRNA reductase;         Short=GluTR;         EC=1.2.1.70;"

OrgPattern ---1--11---------1-1---111111-111111111111111-1-111111-------11----1 121-1111111-1111111-11111111111111111-1111111-1-------------111-11-1-11--------1-1111111-----------11211111111-111111-------11111111111111111---11111111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111111-------------11---------------------------------------------1---------11111-------1-11-111111211---1-2111111--1111--1-11-11----------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111-111111111111111111111111111---111111111111111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111----------------------------------------------11-----111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111I111113114-31-1----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEIS:Sequence : EEGGGHHHHHHHHHHccEEEEEEETTEEEEEEEccTTcH:Sec Str : ===========================================================:RP:SCP|2->152|1gpjA3|7e-34|25.9|139/143|d.58.39.1 :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->149|PF05201|1e-20|36.6|145/152|GlutR_N 61: . . . * . .: 120 :EDEIFDKIFNVFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYK:Sequence :HHHHHHTTHT cTTHHHHHHHHTTccEEEEEEEccTTHHHHHHHHTccEEEEcTTcT:Sec Str : ######################## :PROS|93->116|PS00747|GLUTR|PDOC00608| :============================================================:RP:SCP|2->152|1gpjA3|7e-34|25.9|139/143|d.58.39.1 :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->149|PF05201|1e-20|36.6|145/152|GlutR_N 121: . . + . . .: 180 :TAISDNSISSELQKMFEIAIACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGY:Sequence :TTTGGGGGccEEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHHTTTTccccccc:Sec Str : XXXXXXXXXX :SEG|157->166|vssvsisins :================================ :RP:SCP|2->152|1gpjA3|7e-34|25.9|139/143|d.58.39.1 : ========:RP:SCP|173->279|1omoA|1e-07|16.8|107/320|c.2.1.13 :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->149|PF05201|1e-20|36.6|145/152|GlutR_N 181: . * . . . .: 240 :GEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEIVEVLDFNEKNQVINEVDCIVSCTA:Sequence :cccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHTcTTccEEEEcccG:Sec Str :============================================================:RP:SCP|173->279|1omoA|1e-07|16.8|107/320|c.2.1.13 :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 241: + . . . . *: 300 :APHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKE:Sequence :GGHHHHHHHHHTTTcEEEEcccccccHHHHHHHHHHHHT :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|280->299|ilkdideiskiddknkkirk :======================================= :RP:SCP|173->279|1omoA|1e-07|16.8|107/320|c.2.1.13 :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 301: . . . . + .: 360 :RMEEYKHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNKGNGENAKLAE:Sequence : :Sec Str :============================================================:BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|308->398|PF00745|2e-04|30.8|91/101|GlutR_dimer 361: . . . * . .: 420 :RMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFLT :Sequence : :Sec Str :======================================== :BL:SWS|1->400|HEM1_CLOPE|0.0|100.0|400/400 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|308->398|PF00745|2e-04|30.8|91/101|GlutR_dimer