[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:lacB"

lacB        "galactose-6-phosphate isomerase"
LACB_CLOPE  "RecName: Full=Galactose-6-phosphate isomerase subunit lacB;         EC=5.3.1.26;"

OrgPattern --1-------------1--------------------------------------------------- 1231111111111111111-11111211111112221111----1211111-322111---1122211211-------1111-111111111-1-----111111111-2---------------11111111121111--1121-1-------------------1--1------------------111-111111111111111112111111111111-1244454411111111111111111211111---11--1------11-------211121111211111111111112222222222222121---322211133111111111122111211111212111111111-111121111141121--------------------111111111111---1-----1---1---11222122------------111--------1--1-113---1111111--1111-111111111111111111------------1111----1111--------------1----1-1--1------------------------111-11111111111112111111211-1211111-----111111111111111----3----------------------------------------1-1-1--1--11111----111111-1--1-11111211111--1---------------------------11111111111-------------1--21---2-1-------11----------1-----------------1----------------------------------------11111111--------1-1----1-1-1111111111-1111111111111111111 --------2111--1111--------1---------11111111----1---1-111111111-2---------1-----------------1-1-1111--1------1---------------------------------------------------------------------------1---1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADL:Sequence :cEEEEcccGGGGGGHHHHHHHHGGGTcEEEEccccTTccccccHHHHHHHHHHHHHTccE:Sec Str :============================================================:RP:SCP|1->126|1nn4A|2e-22|39.7|126/159|c.121.1.1 :============================================================:BL:SWS|1->171|LACB_CLOPE|3e-85|100.0|171/171 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->128|PF02502|1e-31|48.8|127/140|LacAB_rpiB 61: . . . * . .: 120 :GVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDII:Sequence :ccEEEEEcccHHHHHTTTTTccEEEcccHHHHHHHHHHTcccEEEEccTTccTTHHHHHH:Sec Str :============================================================:RP:SCP|1->126|1nn4A|2e-22|39.7|126/159|c.121.1.1 :============================================================:BL:SWS|1->171|LACB_CLOPE|3e-85|100.0|171/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->128|PF02502|1e-31|48.8|127/140|LacAB_rpiB 121: . . + . . .: 180 :EAFIKADYIENEENKKIINKINSLEENKPEQNDIHFFDEFLERWNRGEYKD :Sequence :HHHHHHcc :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|129->148|ieneenkkiinkinsleenk :====== :RP:SCP|1->126|1nn4A|2e-22|39.7|126/159|c.121.1.1 :=================================================== :BL:SWS|1->171|LACB_CLOPE|3e-85|100.0|171/171 :$$$$$$$$ :RP:PFM|2->128|PF02502|1e-31|48.8|127/140|LacAB_rpiB