[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:nagA"

nagA        "N-acetylglucosamine-6-phosphate deacetylase"
            ""

OrgPattern ----1---1111111111---------------------------------------1---1------ 111-211-111-1-11111-1---11111111-----2111--123111--1123-11--111111111111---111111-1-----2232-3-------1---1-2-4----------------------------------111111111--111111111-111111-111---1-11-1111-1111-1111111221121112111111111111211122222111-11111111111111111112111121-11111--221121111111111111111111111111111111111111111111111111111-111111111212-2--11111-11-311-----1--11--1111211-12122-------------------11111111111-1111111-11--111111111111------111111111111111111111--1--------------------------------1--1-----111111111111111111111111--1------1---------1-------1----------------------------------------------------------------------1--2111-11-111211111-122211121111--1----------21112111222222222-2222222222222221222111111121211111111111111111122111-12222222222211-------------1-1111111111111111-----------111111111---------111111111-1334222221113322111111111111---1------11111111-----------1-1--111-11-11---11111111111-1 ------1-21-----2-2212111111111111111111111111112111121111-1111111----1--1-1------11111---131-11-2111--1211-1--2111111111-1111113-4A1-21111-111111-11--11-11111111-1-11111111111----------1---2---11---1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAG:Sequence :EEEEccEEEccccEccEEEEEETTEEEEEEEGGGcTccEEEcTTcEEEEcEEEEEEcccT:Sec Str : ===========================================================:RP:SCP|2->74|1ymyA1|7e-13|17.8|73/85|b.92.1.5 : ===========:RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 61: . . . * . .: 120 :GHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVL:Sequence :TccTTTcccHHHHHHHHHHHTTTEEEEEEEEEcccHHHHHHHHHHHHHHHHHcHHccccc:Sec Str :============== :RP:SCP|2->74|1ymyA1|7e-13|17.8|73/85|b.92.1.5 :============================================================:RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 121: . . + . . .: 180 :GAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFL:Sequence :cEEEEcccccGGGcTTccTTTcccccHHcHHHHHHHTGGGEEEEEEcGGGccHcHHHHHH:Sec Str :============================================================:RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 181: . * . . . .: 240 :SEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEITTET:Sequence :HHTTcEEEEccccccHHHHHHHHHHTccEEccTTcccccccTTccHHHHHHHTcTTcEEE:Sec Str :============================================================:RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 241: + . . . . *: 300 :ISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSG:Sequence :EccccccccHHHHHHHHHHHGGGEEEcccccTTTTccccEEEETTEEEEEETTEEEETTT:Sec Str :============================================================:RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 : $$$$$$$$:RP:PFM|293->360|PF01979|2e-05|36.8|68/271|Amidohydro_1 301: . . . . + .: 360 :SLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLILFD:Sequence :EEccccccHHHHHHHHHHTTcccHHHHHHTTTHHHHHHHTcTTTcccccTTccccEEEEc:Sec Str :============================================ :RP:SCP|50->344|1o12A2|8e-98|35.3|286/288|c.1.9.10 : =============:RP:SCP|348->377|1m7jA2|1e-04|43.3|30/61|b.92.1.6 :============================================================:BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|293->360|PF01979|2e-05|36.8|68/271|Amidohydro_1 361: . . . * . .: 420 :DNIDIKYVIVNGKLVHKA :Sequence :TTccEEEEEETTEEEEcG :Sec Str :================= :RP:SCP|348->377|1m7jA2|1e-04|43.3|30/61|b.92.1.6 :============== :BL:SWS|1->374|NAGA_BACSH|5e-73|39.9|373/387