[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:nifU"

nifU        "probable nitrogen fixation protein"
            ""

OrgPattern -----------------------21111111111--------11212111332-----------1--- 1221----------1--------------------------111--------------------111-------------11211111-----------------1---1---------------111111111111222111123-11111-22-----------12111---------------11111111111111111111111122211111111111111111111111111111111111111111------1-11--1111111---1111111111111111111111111111111111111111111111111112111111111111441111111111-11-11222-1112221111-2-1----------1------11111--------------1------1----------------------1111------------11--12-111111111111111111111111111111-----11111111111122221111222222122112111111211221222121121121111111111111122-5422221112111111121214322222133111111111111111111111111222112---1-1121111111111111112111--11--2111111112111-1111111111-111111111111111111112121111111111111111111111111111--111111111111---12222211111----11111111111111111111111112-11111111111112111----------11111111111111--------------1111112222----------1--------------------------11111211111- 1111111-311111211111111111111111111111-1111-11111111111111111111111111221112222211111111-121111111111-12221-21223222111---1131121492-21611111114---1111-13121111-1111111115111111-1I1111132531321111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCG:Sequence :cTTHHHHHHHHHcHHHHTTTccEEEEEEEEEEccEEEEEEEEEEETTEEEEEEEEccTTT:Sec Str : ==========================================================:BL:SWS|3->123|NIFU_AQUAE|4e-38|56.2|121/157 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->124|PF01592|1e-36|55.3|123/126|NifU_N 61: . . . * . .: 120 :SAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQ:Sequence :ccHHHHHHHHHHHTTccccccTTTHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|3->123|NIFU_AQUAE|4e-38|56.2|121/157 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->124|PF01592|1e-36|55.3|123/126|NifU_N 121: . . + . . .: 180 :RQGLEPWDMKEHSHDIHEHVHG :Sequence :HTTc ccccccc :Sec Str :=== :BL:SWS|3->123|NIFU_AQUAE|4e-38|56.2|121/157 :$$$$ :RP:PFM|2->124|PF01592|1e-36|55.3|123/126|NifU_N