[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81490.1 cper0 nifU "probable nitrogen fixation protein"
MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCG
SAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQ
RQGLEPWDMKEHSHDIHEHVHG
//