[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:pfs"

pfs         "probable purine nucleoside phosphorylase"
DEOD_CLOPS  "RecName: Full=Purine nucleoside phosphorylase deoD-type;         Short=PNP;         EC=2.4.2.1;"

OrgPattern 22213211111111114222222-22222122-------------------------21111--1--- ------1-----1----------------------------------1-------1----111---------------1---1-----1111-111---111-21----1-----------------------------11-----1-1---1------------------------------12111---11111111111111111111111111121121111111112-122222222222222111111-1-22-------111211----2222221---1111111111111122222222222221221112221-11-3-------3-42---122211112111------------111-111----------------------------------------------1--1----------------11-----111---------11------------------------------------------------------------------------------------------------1--------------------1---------------1-----1--1-----------1-1111211-------551---11-222224222432242554494--1----11-11132223222222222222-2222222222222222222222222222323232223232332222222221-22222222222211--11111------11-222222122222222-----------------------------222222222-25444444445344-----------------3--------------121----1-2111311111111111111-11---3------ ----21------11---------------------------------------------------------------------------------------11------------------------------------------------------------1------------11----------------1-1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQ:Sequence :HcccccccHHTTccEEEEEccTHHHHHHHTHTcEEEEEEEEETTEEEEEEEETTEEEEEE:Sec Str : =========================================================:RP:SCP|4->233|1a69A|6e-90|51.7|230/237|c.56.2.1 :============================================================:BL:SWS|1->235|DEOD_CLOPS|e-133|100.0|235/235 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->216|PF01048|1e-20|34.7|199/229|PNP_UDP_1 61: . . . * . .: 120 :GTGMGVPSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRF:Sequence :cccccHHHHHHHHHHHHHHTTccEEEEEEEEccccTTccTTcEEEEEEEEEEccGGGHGT:Sec Str :################ :PROS|61->76|PS01232|PNP_UDP_1|PDOC00946| :============================================================:RP:SCP|4->233|1a69A|6e-90|51.7|230/237|c.56.2.1 :============================================================:BL:SWS|1->235|DEOD_CLOPS|e-133|100.0|235/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->216|PF01048|1e-20|34.7|199/229|PNP_UDP_1 121: . . + . . .: 180 :NGLDFAPTASFKLLKAAYDTAVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEM:Sequence :ccTTccEEccHHHHHHHHHHHHHTTccEEEEEEEEEccccGGGTTHHHHHHHTTcccEEc:Sec Str :============================================================:RP:SCP|4->233|1a69A|6e-90|51.7|230/237|c.56.2.1 :============================================================:BL:SWS|1->235|DEOD_CLOPS|e-133|100.0|235/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->216|PF01048|1e-20|34.7|199/229|PNP_UDP_1 181: . * . . . .: 240 :ETAALYTLAAKYGVNALTILTISDHLITAEETTSEERQTTFTKMMEVALDAAITL :Sequence :cHHHHHHHHHTTTcEEEEEEEEEEEcccTTTccHHHHHHHHHHHHHHHHHHHHHH :Sec Str :===================================================== :RP:SCP|4->233|1a69A|6e-90|51.7|230/237|c.56.2.1 :======================================================= :BL:SWS|1->235|DEOD_CLOPS|e-133|100.0|235/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->216|PF01048|1e-20|34.7|199/229|PNP_UDP_1