[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:pgk"

pgk         "phosphoglycerate kinase"
PGK_CLOPE   "RecName: Full=Phosphoglycerate kinase;         EC=2.7.2.3;"

OrgPattern 11111111111111111111111111111111111111111112212111221111111111111-11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111121111111111111111111211111111121111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-------------111111111111111111111111111111111111111213211111121111211211111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11111111112111111111211111111111 1111111-43411111111111111111111111111111111111111111111111111111111111121111111111111111-12111112111111212117121112122212222232515G3-3242222211432122212252111112-22112211211111222O2123394671433532212 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCS:Sequence :HHHTcccGGGcccTTcEEEEEccccccEETTEEcccHHHHHHHHHHHHHHHTTccEEEEc:Sec Str : ########### :PROS|17->27|PS00111|PGLYCERATE_KINASE|PDOC00102| : ========================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 61: . . . * . .: 120 :HMGKPKGEAKPEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQN:Sequence :cccccTTcccTTcccHHHHHHHHHHHTccEEEEcccccccHHHHHccccccTTEEEEEcc:Sec Str :============================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 121: . . + . . .: 180 :TRYRKEETKNGEELSKELASLAEMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKEL:Sequence :GGGcHHHHcEEEcccccEEEccHHEEEccGGGTTcccHHHHcccccHTcEEEcHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|132->143|eelskelaslae :============================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 181: . * . . . .: 240 :KFLGDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTVGS:Sequence :HHHHHHHHcccccEEEEEcccccTTTHHHHHHHTTTccEEEEccTTHHHHHHHTccccTT:Sec Str :============================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 241: + . . . . *: 300 :SLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDVEAVVTEDQNIAEGFMGLDIG:Sequence :ccccTTGGGTHHHHHHHHHHTTcEEEcccEEEEEccccTTccEEETTTcccTTcEEEEEc:Sec Str :============================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 301: . . . . + .: 360 :PKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTIIGGGDSAAAV:Sequence :HHHHHHHHHHHHHccEEEEEcccccTTcGGGcHHHHHHHHHHHHHHcEEEEcccHHTTcE:Sec Str :============================================================:RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :============================================================:BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK 361: . . . * . .: 420 :NILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK :Sequence :EEEcccTTccEEccccHHHHHHHTTcccHHHHTcccc :Sec Str :===================================== :RP:SCP|5->397|13pkA|e-153|51.2|389/415|c.86.1.1 :===================================== :BL:SWS|1->397|PGK_CLOPE|0.0|100.0|397/397 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->386|PF00162|e-127|65.9|378/383|PGK