[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:sdhA.2"

sdhA        "probable L-serine dehydratase alpha subunit"
            ""

OrgPattern ----------------------------------------------------------------1--- 111-112-11111----11-111111111111-----1341---1-11-11-333111--11-1112111-11111111111------1111-111---1111111-1-1--------------1-----------------------------------------1----------------11111--1-1122222111121221111111112211111111111111-1111111111111112111121--11---1111111111----11111111111--1111111111111111111111111111111111-11121111111111-111122221-11-1---11-1--1121111--1-1-22111-1111-1------------111-111111-11-1121-21--111111111111211111111111111--------11111-----------------------------------211111112222222111122222222122331211--11311111--11-1-11----211111-1111--------1112112111--------------11-------1111111-1111111-------2211--111112111112211112122122--1----------32222213333332333-3333333333333333332222221124333444444444434233333331-211111111111---1111111111--111111-111111----111111--1111-22223333133341111111111111-222222222322231111111111-------1--------------1---------------------------1-111-1-----1 -----------2111-1-------------------------------11111111---------------------------------1111111----111222--2------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIARSGAELLEICRENNFSLAEYAIQYEMESKNCTREDVIKGMEKVLQVMKEAANEGQEK:Sequence : ==========================================:RP:SCP|19->282|1szqA|1e-24|9.8|244/473|e.44.1.1 : =========================================================:BL:SWS|4->290|SDHA_BACSU|3e-61|43.4|286/300 61: . . . * . .: 120 :EVYSVSGLIGGDAYKLKKYLEKGDTLTGNVMVGAMARALSCSEVNASMGRIVACPTAGSC:Sequence :============================================================:RP:SCP|19->282|1szqA|1e-24|9.8|244/473|e.44.1.1 :============================================================:BL:SWS|4->290|SDHA_BACSU|3e-61|43.4|286/300 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->277|PF03313|3e-30|39.7|189/275|SDH_alpha 121: . . + . . .: 180 :GILPAVILTVGERLNLSDEELIQGLLASSAVGMIIAQNATLAGAEGGCQAECGSAAAMGA:Sequence : XXXXXXXXXXXXXXXXXXX:SEG|162->189|agaeggcqaecgsaaamgaaatvemmgg :============================================================:RP:SCP|19->282|1szqA|1e-24|9.8|244/473|e.44.1.1 :============================================================:BL:SWS|4->290|SDHA_BACSU|3e-61|43.4|286/300 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->277|PF03313|3e-30|39.7|189/275|SDH_alpha 181: . * . . . .: 240 :AATVEMMGGTPEMALDAGAIVFKNILGLVCDPIAGLVEVPCAKRNFAGAVSALTTADLVM:Sequence :XXXXXXXXX :SEG|162->189|agaeggcqaecgsaaamgaaatvemmgg :============================================================:RP:SCP|19->282|1szqA|1e-24|9.8|244/473|e.44.1.1 :============================================================:BL:SWS|4->290|SDHA_BACSU|3e-61|43.4|286/300 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->277|PF03313|3e-30|39.7|189/275|SDH_alpha 241: + . . . . *: 300 :AGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAITKTGLKLKEKVFGKDK :Sequence :========================================== :RP:SCP|19->282|1szqA|1e-24|9.8|244/473|e.44.1.1 :================================================== :BL:SWS|4->290|SDHA_BACSU|3e-61|43.4|286/300 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|88->277|PF03313|3e-30|39.7|189/275|SDH_alpha