[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB82330.1 cper0 sdhA.2 "probable L-serine dehydratase alpha subunit"
MIARSGAELLEICRENNFSLAEYAIQYEMESKNCTREDVIKGMEKVLQVMKEAANEGQEK
EVYSVSGLIGGDAYKLKKYLEKGDTLTGNVMVGAMARALSCSEVNASMGRIVACPTAGSC
GILPAVILTVGERLNLSDEELIQGLLASSAVGMIIAQNATLAGAEGGCQAECGSAAAMGA
AATVEMMGGTPEMALDAGAIVFKNILGLVCDPIAGLVEVPCAKRNFAGAVSALTTADLVM
AGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAITKTGLKLKEKVFGKDK
//