[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:spmA"

spmA        "spore maturation protein A"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111---------------------------------------------------------------------------------------------------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1------------1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MINYIWFAIIALGLIFSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAEN:Sequence :============================================================:BL:SWS|1->155|SPMA_BACSU|3e-33|40.9|154/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->87|PF06122|7e-04|29.6|71/356|TraH 61: . . . * . .: 120 :SGLTSKVAKLLNPILKKIFKESSHSDEAMGAIVMNLTANMFGLSNAATPLGIKAMSELNK:Sequence :============================================================:BL:SWS|1->155|SPMA_BACSU|3e-33|40.9|154/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->87|PF06122|7e-04|29.6|71/356|TraH 121: . . + . . .: 180 :INKEKDGRASNDMALFLVINAACIQLIPSTVISIRAAAGSSEPASIIIPAIICTFTACCV:Sequence : XXXXXXXXXXXXXXXXX :SEG|156->172|aaagssepasiiipaii :=================================== :BL:SWS|1->155|SPMA_BACSU|3e-33|40.9|154/100 181: . * . . . .: 240 :GIICCKILQRYF :Sequence