[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB82239.1 cper0 spmA "spore maturation protein A"
MINYIWFAIIALGLIFSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAEN
SGLTSKVAKLLNPILKKIFKESSHSDEAMGAIVMNLTANMFGLSNAATPLGIKAMSELNK
INKEKDGRASNDMALFLVINAACIQLIPSTVISIRAAAGSSEPASIIIPAIICTFTACCV
GIICCKILQRYF
//