[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:spoIIIAG"

spoIIIAG    "stage III sporulation protein AG"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-1111-111111-1---------1------------------------------------------------------------------------------------------11111111111111111111111111--1--1111111-1---111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKILKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDS:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|3->21|kilkqknitnliillllvi : =======================================:BL:SWS|22->193|SP3AG_BACSU|4e-10|30.8|172/100 61: . . . * . .: 120 :EVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGT:Sequence : XXXXXXXXXXXX:SEG|109->120|stteetdseggt :============================================================:BL:SWS|22->193|SP3AG_BACSU|4e-10|30.8|172/100 121: . . + . . .: 180 :RVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLY:Sequence :============================================================:BL:SWS|22->193|SP3AG_BACSU|4e-10|30.8|172/100 181: . * . . . .: 240 :NISVDKVNVLAMKK :Sequence :============= :BL:SWS|22->193|SP3AG_BACSU|4e-10|30.8|172/100