[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81533.1 cper0 spoIIIAG "stage III sporulation protein AG"
MSKILKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDS
EVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGT
RVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLY
NISVDKVNVLAMKK
//