[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:spoIIIE"

spoIIIE     "stage III sporulation protein E"
FTSK_CLOPE  "RecName: Full=DNA translocase ftsK;"

OrgPattern -----------------------------------------------1-------------------- 1111722222222223455-533343555553444431122233231122313332211132212235231222211111111-----111111111--11111111112111111111111111-11111111112112211121-11------------------11--------------11111111133333333243343342333333345234331133333421233343433433334222221121221111122112211211111122212222111111121111111111111121112111111111111512111111111112211111131121211323211111111111-1112111122222111211111111122222222222-22222322221222222222222222111111111111111111111111111121111111111111111111111111111111121111112322222222222222222222222222211222131112211111111111212222222111111112111111111111111111111111111111111111111111221211111111-11111111112111111111211111111111-11111------11111111111111111-1111111111111111111111111121111111111111111111111111-11111111111111-1111111111111111111-11111-11111111111111111111111111211111111111111111111111111111111111111121111111111111111111121111----1------1-----------------------211 -1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------1---------- ------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAGGKKKTATKTQKKKNQSQIKVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLI:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|5->22|kkktatktqkkknqsqik :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 61: . . . * . .: 120 :GLFGIGAFFIPIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQG:Sequence : :Sec Str :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 121: . . + . . .: 180 :SIWGSIKTIWHSQSEWHGGVVGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVS:Sequence : cHHHHHHHHHHTTcH:Sec Str :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 181: . * . . . .: 240 :IRNFFGGFKEKASKVKFVDKKYEKDDYINLKKKDGASEGNKESKKDDISEDNNKIKILDF:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTEEEEEEEETTEEEEEEEEEET:Sec Str : =====================================================:RP:SCP|188->311|1tzoA|5e-04|10.5|124/553|f.11.1.1 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|199->314|PF12128|3e-05|28.2|110/1179|DUF3584 241: + . . . . *: 300 :MKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLSLDNTIIEQRGFNSEKAKEEE:Sequence :TEEcHHHHHHHHHHHHHTcccccEEEEEEEEEEEcccTTEEEEEEEEEEEEccccccEEE:Sec Str :============================================================:RP:SCP|188->311|1tzoA|5e-04|10.5|124/553|f.11.1.1 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|199->314|PF12128|3e-05|28.2|110/1179|DUF3584 301: . . . . + .: 360 :SIDKEISNNIASKGSSVGASYVAPNADLLNLNNNNELDKDDKKALLANAAKLEETLMSFG:Sequence :EEEEEEEEEHHHHHHHH Tccccc:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|325->354|nadllnlnnnneldkddkkallanaaklee :=========== :RP:SCP|188->311|1tzoA|5e-04|10.5|124/553|f.11.1.1 : ===:RP:SCP|358->441|1mg7A2|1e-10|12.0|75/187|d.58.26.6 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$$$$$ :RP:PFM|199->314|PF12128|3e-05|28.2|110/1179|DUF3584 361: . . . * . .: 420 :VEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI:Sequence :ccccEEEEEccTTTccHHHHHHHTccEEEEETTcccHHHHHHHHTTTTcTTTccccEEEE:Sec Str :============================================================:RP:SCP|358->441|1mg7A2|1e-10|12.0|75/187|d.58.26.6 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 421: . . + . . .: 480 :EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSG:Sequence :EcccccEEcccccccccccEEEcTTcEEEEEEccGGGTTcccccEEEcccTTHHHHccTT:Sec Str :===================== :RP:SCP|358->441|1mg7A2|1e-10|12.0|75/187|d.58.26.6 : ===:RP:SCP|478->564|1xppA|2e-25|18.6|86/99|d.74.3.2 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->622|PF01580|2e-65|67.1|170/186|FtsK_SpoIIIE 481: . * . . . .: 540 :KSVCINTLIVSILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWA:Sequence :cEEEETTTTEEEEEEEcccEEEEEEEEcEEEccccEEEcTTcccccccccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|478->564|1xppA|2e-25|18.6|86/99|d.74.3.2 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->622|PF01580|2e-65|67.1|170/186|FtsK_SpoIIIE 541: + . . . . *: 600 :VNEMTRRYKLFADNGVRNIESYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYI:Sequence :HHHTccEEEETTcccHHHHHHHHHHHTTTTTTcEEEEEEEEEEHHHHHHHccGGGHHHHH:Sec Str :======================== :RP:SCP|478->564|1xppA|2e-25|18.6|86/99|d.74.3.2 : ============================:RP:SCP|573->754|1sfnA|1e-24|10.1|178/245|b.82.1.11 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->622|PF01580|2e-65|67.1|170/186|FtsK_SpoIIIE 601: . . . . + .: 660 :CRLAQMARAAGMHLVIATQRPSVDVITGVIKANIPSRISFAVSSQIDSRTILDSAGAEKL:Sequence :HHHHHHHHHHTccEEEEccTTGGGGTcccccHHHHHHHHHHHHHTccEEEEcHHHHTccc:Sec Str :============================================================:RP:SCP|573->754|1sfnA|1e-24|10.1|178/245|b.82.1.11 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|452->622|PF01580|2e-65|67.1|170/186|FtsK_SpoIIIE 661: . . . * . .: 720 :LGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQRDAQYEEDILEHINSATIAS:Sequence :HHHHHHHHHHHHHHHHHHccHHHHHHHHHHTccccccHHHHHHHHHHHHHHHTTcccEHH:Sec Str :============================================================:RP:SCP|573->754|1sfnA|1e-24|10.1|178/245|b.82.1.11 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 721: . . + . . .: 780 :EGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEECGVISRRDGS:Sequence :HHHHHHHHHHHHHTcccEEEEccccHHHHHHHTTcccccEEEEEccHHHHTTcEEEEEET:Sec Str :================================== :RP:SCP|573->754|1sfnA|1e-24|10.1|178/245|b.82.1.11 : ======================================================:RP:SCP|727->793|2ve8A1|1e-25|41.8|67/67|a.4.5.67 :============================================================:BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|723->790|PF09397|2e-20|62.7|67/67|Ftsk_gamma 781: . * . . . .: 840 :KPRQVLLSKDELENMK :Sequence :TEEEEEEccHHHH :Sec Str :============= :RP:SCP|727->793|2ve8A1|1e-25|41.8|67/67|a.4.5.67 :================ :BL:SWS|1->796|FTSK_CLOPE|0.0|100.0|796/796 :$$$$$$$$$$ :RP:PFM|723->790|PF09397|2e-20|62.7|67/67|Ftsk_gamma