[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81382.1 cper0 spoIIIE "stage III sporulation protein E"
MAGGKKKTATKTQKKKNQSQIKVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLI
GLFGIGAFFIPIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQG
SIWGSIKTIWHSQSEWHGGVVGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVS
IRNFFGGFKEKASKVKFVDKKYEKDDYINLKKKDGASEGNKESKKDDISEDNNKIKILDF
MKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLSLDNTIIEQRGFNSEKAKEEE
SIDKEISNNIASKGSSVGASYVAPNADLLNLNNNNELDKDDKKALLANAAKLEETLMSFG
VEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSG
KSVCINTLIVSILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWA
VNEMTRRYKLFADNGVRNIESYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYI
CRLAQMARAAGMHLVIATQRPSVDVITGVIKANIPSRISFAVSSQIDSRTILDSAGAEKL
LGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQRDAQYEEDILEHINSATIAS
EGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEECGVISRRDGS
KPRQVLLSKDELENMK
//