[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:thrS"

thrS        "threonine-tRNA ligase"
SYT_CLOPE   "RecName: Full=Threonyl-tRNA synthetase;         EC=6.1.1.3;AltName: Full=Threonine--tRNA ligase;         Short=ThrRS;"

OrgPattern 11111111222222211111111111111111211111111111111111111111111111121111 1111211111111111111-11111111111111112211122212112111111112112211112121111111111112112222111111111--1111111111111111111111111211111211121111111111133111121111111111111122211111111111211111111111122222222222222221222222211121111111111211111111111111121121112122111111122221212112221112111111222222222222222222222212122222222211112111111111221111111212111111111111111111111122111111111111111211111111111111111111-11111111111111111111111111111112111111111111111111111112211111111111111111111111111111111122222111112211111121111111221222211222211111111112231112211111111111221211111112111111111111111111121111111211111211111111111111111112111121212222111111111111111-1111111111121111211111111111-11111111111111111111121121111111111111111111111111111111111111111212111111111111212111121111111111111111111111111112111111111111111111111111211111211112111111111111111111111111111111111111111-11111111111111111111111121222111 1111222-311122211222222222222222222122222222222222222212222222222222222122222-2322222222-1311111111111222212B324734643323333573639T3-66B3333933442334333494433213A11121311512322222F2222242442432252223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEIC:Sequence : ccccccccTTcccccEETTEEEEEEEccTHHHHccETcccEEEEccGGGcEEEEEEEEE:Sec Str : ========================================================== :RP:SCP|2->59|1nyqA2|2e-14|41.4|58/59|d.15.10.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->61|PF02824|2e-06|35.0|60/60|TGS 61: . . . * . .: 120 :TFDSKEGQHAFNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNKL:Sequence :EccccGGGHHHHHcccccEEEEEEEEccccccTTHHHHHHHHHHHHTGGGTTccTTcccE:Sec Str : XX:SEG|119->135|kleeemkkiikenpeik :============================================================:RP:SCP|61->239|1nyqA3|7e-39|39.1|179/179|d.67.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 :$ :RP:PFM|2->61|PF02824|2e-06|35.0|60/60|TGS 121: . . + . . .: 180 :EEEMKKIIKENPEIKRFELPRNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCA:Sequence :EEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHHTTTccEEEEEEEEEEEccccccccc:Sec Str :XXXXXXXXXXXXXXX :SEG|119->135|kleeemkkiikenpeik :============================================================:RP:SCP|61->239|1nyqA3|7e-39|39.1|179/179|d.67.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 : $$$$$$$$$:RP:PFM|172->216|PF07973|2e-05|60.5|38/44|tRNA_SAD 181: . * . . . .: 240 :GPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSELDAYLEALEEAKKRD:Sequence :cTTEEEEEEETTEEEEEEcccHHHHHHHTTHHHHHHHHHHHHHHHTcccEEEEEEccccc:Sec Str : XXXXXXXXXXXX :SEG|225->236|eldaylealeea :=========================================================== :RP:SCP|61->239|1nyqA3|7e-39|39.1|179/179|d.67.1.1 : ==:RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|172->216|PF07973|2e-05|60.5|38/44|tRNA_SAD 241: + . . . . *: 300 :HNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSD:Sequence :ccccccHHHHHHHHTcccTTcEEEcHHHHHHHHHHHHHHHHHTHHHTcEEcccccEEEHH:Sec Str :============================================================:RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|271->414|PF00587|4e-17|34.0|141/170|tRNA-synt_2b 301: . . . . + .: 360 :LYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETS:Sequence :HHHHHcGGGTcGGGccHHHHHHcccccEEEcccccGGGGGTTTTcEEcGGGccEEEEEcc:Sec Str :============================================================:RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|271->414|PF00587|4e-17|34.0|141/170|tRNA-synt_2b 361: . . . * . .: 420 :TLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY:Sequence :cEEEcccccccccTTcccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHTcccccEEE:Sec Str :============================================================:RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|271->414|PF00587|4e-17|34.0|141/170|tRNA-synt_2b 421: . . + . . .: 480 :RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVH:Sequence :EEEccccEEEEEEEccGGGcTGGGcTTcccTTcccEEEEEEEEEETHHHHHHTcEETTcc:Sec Str :============================================================:RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 481: . * . . . .: 540 :GKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALP:Sequence :ccEEEEEEEEHHHHHHHHHHHHcEcccccTTcccEEEEEEEEEHHHHHHHHHHHHcccGG:Sec Str :========================================================= :RP:SCP|239->537|1evkA2|1e-92|36.6|290/291|d.104.1.1 : =========================:RP:SCP|516->640|1o6dA|1e-24|10.4|125/147|c.116.1.3 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 541: + . . . . *: 600 :TWIAPVQAKVLPLSDKYADYANEVVEELRRRGVRVEADHRAEKIGYKIREARLERTPYIL:Sequence :GccHHHHHHHccccccccccHHHHHHHHHTTTcccEEEcccccHHHHHHHHHHTTccEEE:Sec Str : XXXXXXXXXXXXXX :SEG|563->576|evveelrrrgvrve :============================================================:RP:SCP|516->640|1o6dA|1e-24|10.4|125/147|c.116.1.3 :============================================================:BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|550->636|PF03129|2e-11|34.5|87/91|HGTP_anticodon 601: . . . . + .: 660 :VVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIANREN :Sequence :EEcHHHHTccTEEEEETTTccEEEEEHHHHHHHHHHHcEHEEE :Sec Str :======================================== :RP:SCP|516->640|1o6dA|1e-24|10.4|125/147|c.116.1.3 :=========================================== :BL:SWS|1->643|SYT_CLOPE|0.0|100.0|643/643 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|550->636|PF03129|2e-11|34.5|87/91|HGTP_anticodon